Myneta.info is an open data repository platform of Association for Democratic Reforms (ADR).
Myneta Logo Myneta Logo
Home Lok Sabha State Assemblies Rajya Sabha Political Parties Electoral Bonds || माय नेता हिंदी में || About MyNeta About ADR
State Assemblies Rajya Sabha Political Parties
1 2 3 4
HomeAndhra Pradesh 2024VISAKHAPATNAMNARSIPATNAMAYYANNAPATRUDU CHINTAKAYALA(Criminal & Asset Declaration)

Andhra Pradesh 2024

profile image

AYYANNAPATRUDU CHINTAKAYALA (Winner)

NARSIPATNAM (VISAKHAPATNAM)
Party:TDP
S/o|D/o|W/o: Late Varahalu Dora
Age: 66
Name Enrolled as Voter in: 34 - Narasipatnam Assembly (Andhra Pradesh) constituency, at Serial no 735 in Part no 162

Self Profession:Politician
Spouse Profession:Business

Crime-O-Meter


Number of Criminal Cases: 17

Assets & Liabilities


Assets: Rs 21,82,32,557 ~21 Crore+
Liabilities: Rs 2,86,73,579 ~2 Crore+

Educational Details


Category: 12th Pass
Intermediate (Board of Secondary Education , Andra Pradesh -1975)

Details of PAN and status of Income Tax return

Relation TypePAN GivenFinancial YearTotal Income Shown in ITR
selfY2022 - 20232022 - 2023 ** Rs 7,90,000 ~ 7 Lacs+
2021 - 2022 ** Rs 7,16,350 ~ 7 Lacs+
2020 - 2021 ** Rs 8,63,030 ~ 8 Lacs+
2019 - 2020 ** Rs 10,06,610 ~ 10 Lacs+
2018 - 2019 ** Rs 17,80,720 ~ 17 Lacs+
spouseY2022 - 20232022 - 2023 ** Rs 21,68,360 ~ 21 Lacs+
2021 - 2022 ** Rs 33,35,380 ~ 33 Lacs+
2020 - 2021 ** Rs 23,14,380 ~ 23 Lacs+
2019 - 2020 ** Rs 27,44,900 ~ 27 Lacs+
2018 - 2019 ** Rs 16,94,030 ~ 16 Lacs+
hufY2021 - 20222021 - 2022 ** Rs 1,00,100 ~ 1 Lacs+
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
dependent1NNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
dependent2NNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
dependent3NNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
Data Readability Report of PAN and Income Tax :No Problems in Reading Affidavit Information

Details of Criminal Cases

Brief Details of IPCs

Cases where Pending

Serial No.FIR No.Case No.CourtIPC Sections ApplicableOther Details / Other Acts / Sections Applicable Charges Framed Date on which charges were framedAppeal FiledDetails and present status of appeal
1 212/2023 Dated 23-08-2023 Atkur PS, Krishna District 153A, 354A(i)(iv), 504, 505(2), 509 No No
2 64/2022 Dated 02-11-2022 CID PS, Mangalagiri, Amaravathi, AP 464, 467, 471, 474, 120B, 34 No No
3 317/2022 Dated 22-06-2022, III Town PS, Visakhapatnam 153, 153A, 504, 505, 500 Section 67 ITA act 2000 - 2008 No No
4 80/2022, Dt 16-04-2022, Narsipatnam Town PS 353, 294A, 294B, 504, 505(1)B, 505(2), 506, 34 No No
5 105/2022 Dated 20-02-2022 Nallajerla PS, West Godavari Dt. 153A, 505(2), 506 No No
6 293/2021 Dated 24-11-2021 Narsipatnam Town PS 188, 353, 153A, 505, 504, 269, 270, 34 Section 3 PA 1922, Section 3 EDA 1897, Section 51(b) DMA 2025, Section 30 PA 1861 No No
7 621/2021 Dated 24-09-2021, Arundalpet PS, Guntur Urban 294, 504, 509 Section 3(1)(r), 3(2)(va) SC ST POA Act No No
8 217/2021 Dated 18-09-2021, Nakarekal PS, Guntur 188, 270, 504, 505(2), 509 Section 51(b) DM act - 2005 section 3(1)(r) SC ST POA Act No No
9 216/2021 Dated 17-09-2021, Nakarekal PS, Guntur 153A, 505, 504, 501 No No
10 104/2021 Dated 09-07-2021, Kotananduru PS, Kakinada District C.C.No.04/2023 Addl Junior Civil Judge Court cum JFCM Court at Tuni188, 269, 270 Dt.- 27.01.2023 No No
11 777/2020 Dt. 16-06-2020, Narsipatnam Town PS 354A(i)(iv), 500, 504, 505(1)b, 505(2), 506, 509 No No
12 774/2020 Dated 15-06-2020 Narsipatnam Town PS C.C 1217/2021 Addl Junior Civil Judge Court cum JFCM Court at Narsipatnam188, 269, 270, 34 Section 30 PA - 1861, Section 51(b) DMA - 2005, Section 3 EDA 1897 No No
13 690/2020 Dated 28-05-2020 Narsipatnam Town PS S.C.No. (special) 114/2021 Special court for SC & ST cum XI ADJ Court at Visakhapatnam section 3(1)(r), 3(1)(u), SC ST POA Dt-06.09.2021 No No
14 221/2020 Dated 16-05-2020 Korukonda PS, Rajahmundry District 143, 188, 269, 270, 34 Section 2, 3, 4, EDA Act No No
15 10/2020 Dated 06-01-2020 Narsipatnam Town PS C.C 1693/2022 Addl Junior Civil Judge Court cum JFCM Court at Narsipatnam341, 188, 189, 504, 505(1)B, 117 Section 9 - II APGA, Dt-21.06.2022 No No
16 542/2019, Dt 20.12.2019 Narsipatnam Town PS C.C 1694/12022, Addl Junior Civil Judge Court cum JFCM Court at Narsipatnam 179, 186, 189, 353, 500, 504 Dt-21.06.2022 No No
17 361/2019 Dated. 25.09.2019, III Town PS, Visakhapatnam 153A, 500, 506 No No

Cases where Convicted

Serial No.Case No.CourtIPC Sections ApplicableOther Details / Other Acts / Sections Applicable Punishment ImposedDate on which convictedAppeal FiledDetails and present status of appeal
---------No Cases--------

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Criminal Cases :No Problems in Reading Affidavit Information

Details of Movable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iCash 3,00,000  3 Lacs+

2,00,000  2 Lacs+

50,000  50 Thou+

NilNilNil Rs 5,50,000
5 Lacs+
iiDeposits in Banks, Financial Institutions and Non-Banking Financial CompaniesUnion Bank , Narsipatnam, A/c No. 038310021050867
9,53,270.89  9 Lacs+

SBI Narsipatnam, A/c No. 38337812646
40,840  40 Thou+

SBI , A/c No. 52088484142
47,63,932.03  47 Lacs+

SBI, Siripuram, A/c No. 33849973924
21,714.50  21 Thou+

Union Bank of Narsipatnam Ac No. 038311010000056 Election Purpose
10,000  10 Thou+

Union Bank , Narsipatnam, A/c No. 038310027000768
5,59,739.05  5 Lacs+

SBI Narsipatnam, A/c No. 32234050061
12,40,598.28  12 Lacs+

SBI Golugonda, A/c No. 62170494923
22,488  22 Thou+

SBI Visakhapatnam, A/c No. 30228930252
3,01,56,056.09  3 Crore+

NilNilNilNil Rs 3,77,68,638.84
3 Crore+
iiiBonds, Debentures and Shares in companiesRanar Agrochem Ltd. - 35000 shares
3,50,000  3 Lacs+

Chodavaram Co-operative sugars society - 1000 shares
1,000  1 Thou+

Ranar Agrochem Ltd. - 35000 shares 3,50,000 3 Lacs+
3,50,000  3 Lacs+

Chodavaram Co-operative sugars society - 1000 shares
1,000  1 Thou+

NilNilNilNil Rs 7,02,000
7 Lacs+
iv(a)
NSS, Postal Savings etc
NilNilNilNilNilNil Nil
(b)
LIC or other insurance Policies
LIC Policy No. 693557557
12,62,275  12 Lacs+

LIC Policy No. 694919963
29,76,643  29 Lacs+

LIC Policy No. 2K436234704
12,40,500  12 Lacs+

NilNilNilNil Rs 54,79,418
54 Lacs+
vPersonal loans/advance given NilNilNilNilNilNil Nil
viMotor Vehicles (details of make, etc.)Innova - 2019 AP39BG4599
29,00,000  29 Lacs+

Mahindra Jeep, 1993, AP315499
30,000  30 Thou+

Fortuner - 2016 TS09 ET 6446
37,39,000  37 Lacs+

NilNilNilNil Rs 66,69,000
66 Lacs+
viiJewellery (give details weight value)Gold 100 gms
7,00,000  7 Lacs+

Gold 1000 gms
70,00,000  70 Lacs+

Silver 4Kgs
3,56,000  3 Lacs+

NilNilNilNil Rs 80,56,000
80 Lacs+
viiiOther assets, such as values of claims / interestsNilMargadarsi Chit
82,800  82 Thou+

NilNilNilNil Rs 82,800
82 Thou+
Gross Total Value (as per Affidavit) 1,13,33,032.42  1 Crore+ 4,79,24,824.42  4 Crore+ 50,000  50 Thou+ Nil Nil Nil Rs 5,93,07,856.84
5 Crore+
Totals (Calculated as Sum of Values) Rs 1,13,33,032.42
1 Crore+
Rs 4,79,24,824.42
4 Crore+
Rs 50,000
50 Thou+
Nil
Nil
Nil
Rs 5,93,07,856.84
5 Crore+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Movable Assets :No Problems in Reading Affidavit Information

Details of Immovable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iAgricultural Land(l) Gabbada Sy.No. l9l -3, Sy.No.l9l -10
Total Area 1.45 Acres
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
21,75,000  21 Lacs+

(2) Allipudi, Kakinada Dist, Sy.No. 261,
Total Area 2.08 Acres
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
11,96,000  11 Lacs+

(3) Narsipatnam, Sy.No,229, (i) Area 2.76 Acres Whether inherited property - No Date of purchase - 31-03-2004 Cost of Land - 254000 Narsipatnam, Sy.No,229, (ii) Area 2 Acres Whether inherited property - Yes
Total Area
Built Up Area
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
2,14,20,000  2 Crore+

4) Narsipatnam, Sy.No.224,
Total Area 0.50 Acres
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
22,50,000  22 Lacs+

(5) Narsipatnam.SY No. 227
Total Area 0.50
Built Up Area
Whether Inherited N
Purchase Date 2004-03-31
Purchase Cost 58000.00
Development Cost 0.00
22,50,000  22 Lacs+

Cheedigumala Sy.No. 88, 89, 93, 93/7, 106/7,111/5, 112, 96, 106/2, 106/3,107,111/1
Total Area 15.27 Acres
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
1,00,78,200  1 Crore+

Narsipatram Sy.No.278 - l
Total Area 0.44 Acres
Built Up Area
Whether Inherited N
Purchase Date 2018-05-28
Purchase Cost 748000.00
Development Cost 0.00
19,80,000  19 Lacs+

NilNilNilNil Rs 4,13,49,200
4 Crore+
iiNon Agricultural Land(I )Pedaboddepalli, Sy.No.54-3,
Total Area 0.37Acres
Built Up Area
Whether Inherited N
Purchase Date 2007-12-01
Purchase Cost 37000.00
Development Cost 0.00
11,84,000  11 Lacs+

Narsipatoam. Sy.No.l32/ 2i, Area - 61 Sq. Yards, Date of Purchase 10-04-2000 Cost of Land 9200 Narsipatram, Sy.No. 132/3. Area - 123 Sq Yards Date of Purchase 14-06-1999 Cost of Land 18500
Total Area
Built Up Area
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
11,96,000  11 Lacs+

RR Dist. Bommaraspet. Sy.No. 371, 387, 388, 389
Total Area 1000 Sq Yards
Built Up Area
Whether Inherited N
Purchase Date 2002-10-23
Purchase Cost 100000.00
Development Cost 0.00
23,00,000  23 Lacs+

(l)Pedaboddepalli, Sy.No.55, Area - 901.5 Sq Yards (2) Pedaboddepalli Sy.No.54/3, Area - 2420 Sq Yards
Total Area
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
1,32,86,000  1 Crore+

(3) Pedaboddepalli Sy.No.359,4
Total Area 1170 Sq Yards
Built Up Area
Whether Inherited N
Purchase Date 2005-11-18
Purchase Cost 550000.00
Development Cost 0.00
58,50,000  58 Lacs+

(4) Narsipatram Sy.No.274
Total Area 629.2 Sq Yards
Built Up Area
Whether Inherited N
Purchase Date 2022-02-14
Purchase Cost 1700000.00
Development Cost 0.00
31,46,000  31 Lacs+

(5) Pedaboddepal Sy.No.328
Total Area 320 Sq Yards
Built Up Area
Whether Inherited N
Purchase Date 2018-10-01
Purchase Cost 480000.00
Development Cost 0.00
12,80,000  12 Lacs+

NilNilNilNil Rs 2,82,42,000
2 Crore+
iiiCommercial BuildingsNilPadmavathi Shopping Complex, Balighattam Sy.No. 29-2B/1 Narsipatnam Muricipality, Anakapalli District
Total Area 444.5 Sq.yards
Built Up Area 15700 Sft
Whether Inherited N
Purchase Date 1995-08-01
Purchase Cost 102500.00
Development Cost 0.00
2,53,88,500  2 Crore+

Pedaboddepalli SY No. 359/2
Total Area 1170 Sq.yards
Built Up Area
Whether Inherited N
Purchase Date 2005-11-18
Purchase Cost 550000.00
Development Cost 0.00
58,50,000  58 Lacs+

) Joint Ownership 22nd , Floor .50"/" share. Golf Edqe Apartment, Rangareddy District,Telangana Commercial Space, Sy.No. 27/1 - 4 part
Total Area 11765 Sft
Built Up Area 11765 Sft
Whether Inherited N
Purchase Date 2018-05-19
Purchase Cost 14706250.00
Development Cost 0.00
3,88,24,500  3 Crore+

NilNilNilNil Rs 7,00,63,000
7 Crore+
ivResidential BuildingsDeepanjali Apartment, ,Siripura m, Visakhapatnam, Sy.No.79,
Total Area 115 sq.yards
Built Up Area 2766 Sft
Whether Inherited N
Purchase Date 2001-12-01
Purchase Cost 1202000.00
Development Cost 0.00
1,33,05,500  1 Crore+

G+01st Floor, l/4 th share, Narsipatnam, Sy.No. l32/2i
Total Area 121 sq.yards
Built Up Area 666.25 Sft, 503.75 Sft
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
19,58,125  19 Lacs+

I /4 th share in tiled house. Narsipatnam Sy.No.132/2
Total Area 145 sq.yards
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
12,26,875  12 Lacs+

(l) Excelsior Apartment, Ramnagar. Visakhapatnam, TS No.l08 - 8, Sy No. I196/18 & Sy No. 1196/27
Total Area 27.5Sq.yards
Built Up Area 1200 Sft
Whether Inherited N
Purchase Date 1995-04-29
Purchase Cost 198000.00
Development Cost 0.00
27,80,000  27 Lacs+

NilNilNilNil Rs 1,92,70,500
1 Crore+
vOthersNilNilNilNilNilNil Nil
Total Current Market Value of (i) to (v) (as per Affidavit) 5,04,61,500  5 Crore+ 10,84,63,200  10 Crore+ Nil Nil Nil Nil Rs 15,89,24,700
15 Crore+
Totals Calculated Rs 5,04,61,500
5 Crore+
Rs 10,84,63,200
10 Crore+
Nil
Nil
Nil
Nil
Rs 15,89,24,700
15 Crore+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Immovable Assets :No Problems in Reading Affidavit Information

Details of Liabilities

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iLoans from Banks / FIsNilLIC Loan
22,80,000  22 Lacs+

Loan from SBI
81,92,965  81 Lacs+

SBI Loan
33,43,069  33 Lacs+

NilNilNilNil Rs 1,38,16,034
1 Crore+
Loans due to Individual / EntityNilSantiam Estates Pvt Ltd
39,77,545  39 Lacs+

Sri Narahari Pullayya
45,00,000  45 Lacs+

Sri Surya Venkata Subba Rao
55,00,000  55 Lacs+

Raj kamal Poultries Pvt Ltd.
1,80,000  1 Lacs+

I.A. Raja Varma
7,00,000  7 Lacs+

NilNilNilNil Rs 1,48,57,545
1 Crore+
Any other LiabilityNilNilNilNilNilNil Nil
Grand Total of Liabilities (as per affidavit) Nil 2,86,73,579  2 Crore+ Nil Nil Nil Nil Rs 2,86,73,579
2 Crore+
iiDues to departments dealing with government accommodationNilNilNilNilNilNil Nil
Dues to departments dealing with supply of waterNilNilNilNilNilNil Nil
Dues to departments dealing with supply of electricityNilNilNilNilNilNil Nil
Dues to departments dealing with telephonesNilNilNilNilNilNil Nil
Dues to departments dealing with supply of transportNilNilNilNilNilNil Nil
Income Tax DuesNilNilNilNilNilNil Nil
Wealth Tax DuesNilNilNilNilNilNil Nil
Service Tax DuesNilNilNilNilNilNil Nil
Property Tax DuesNilNilNilNilNilNil Nil
Sales Tax DuesNilNilNilNilNilNil Nil
GST DuesNilNilNilNilNilNil Nil
Any Other DuesNilNilNilNilNilNil Nil
iiiGrand Total of all Govt Dues (as per affidavit) Nil Nil Nil Nil Nil Nil Nil
ivWhether any other liabilities are in dispute, if so, mention the amount involved and the authority before which it is pendingNilNilNilNilNilNil Nil
Totals (Calculated as Sum of Values) Nil
Rs 2,86,73,579
2 Crore+
Nil
Nil
Nil
Nil
Rs 2,86,73,579
2 Crore+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Liabilities :No Problems in Reading Affidavit Information

Profession or Occupation

Self Politician
Spouse Business

Sources Of Income (Details)

Self Pension
Spouse Business & Agricultural Income
Dependent NA

Contracts with appropriate Govt. and any public company/companies

Details of contracts entered by the candidate NIL
Details of contracts entered into by spouse NIL
Details of contracts entered into by dependent NIL
Details of contracts entered into by Hindu undivided family or trust in which the candidate or spouse or dependents have interest NIL
Details of contracts entered into by Partnership Firms in which the candidate or spouse or dependents are partners NIL
Details of contracts entered into by Private Companies in which candidate or spouse or dependents have share NIL



If you notice any discrepancy between affidavits and our data, you can use the message box below to send a message to us.

( यदि आप हलफनामों और इस पेज पर दी गयी जानकारी के बीच कोई विसंगति/भिन्नता पाते है तो आप नीचे के संदेश बॉक्स के उपयोग से हमें संदेश भेज सकते हैं)

Name
Email
Phone No
Enter your discrepancy
Please enter the code shown below and click Submit.




Share On:
Download App Follow us on

Disclaimer: All information on this website has been taken by ADR from the website of the Election Commission of India (https://affidavitarchive.nic.in/) and all the information is available in public domain. ADR does not add or subtract any information, unless the EC changes the data. In particular, no unverified information from any other source is used. While all efforts have been made by ADR to ensure that the information is in keeping with what is available in the ECI website, in case of discrepancy between information provided by ADR through this report, anyone and that given in the ECI website, the information available on the ECI website should be treated as correct and Association for Democratic Reforms and their volunteers are not responsible or liable for any direct, indirect special, or consequential damages, claims, demands, losses of any kind whatsoever, made, claimed, incurred or suffered by any party arising under or relating to the usage of data provided by ADR through this report. It is to be noted that ADR undertakes great care and adopts utmost due diligence in analysing and dissemination of the background information of the candidates furnished by them at the time of elections from the duly self-sworn affidavits submitted with the Election Commission of India. Such information is only aimed at highlighting the growing criminality in politics, increased misuse of money in elections so as to facilitate a system of transparency, accountability and good governance and to enable voters to form an informed choice. Therefore, it is expected that anyone using this report shall undertake due care and utmost precaution while using the data provided by ADR. ADR is not responsible for any mishandling, discrepancy, inability to understand, misinterpretation or manipulation, distortion of the data in such a way so as to benefit or target a particular political party or politician or candidate.

About MyNeta About ADR State Coordinators Contact Terms of Use FAQs