is an open data repository platform of Association for Democratic Reforms (ADR).
Myneta Logo Myneta Logo
Home Lok Sabha State Assemblies Rajya Sabha Political Parties Electoral Bonds || माय नेता हिंदी में || About MyNeta About ADR
State Assemblies Rajya Sabha Political Parties
1 2 3 4
HomeTamil Nadu 2021NAGAPATTINAMVEDHARANYAMV.VEERAKUMAR(Criminal & Asset Declaration)

Tamil Nadu 2021

profile image


S/o|D/o|W/o: Veerasamy
Age: 32
Name Enrolled as Voter in: Vedharanyam (Tamil Nadu) constituency, at Serial no 884 in Part no 110

Self Profession:Agriculture
Spouse Profession:Nil


No criminal cases

Assets & Liabilities

Assets: Rs 10,61,546 ~10 Lacs+
Liabilities: Rs 10,000 ~10 Thou+

Educational Details

Category: 5th Pass
6th Passed, Theni Middle School, Rasapuram-2001

Details of PAN and status of Income Tax return

Relation TypePAN GivenFinancial YearTotal Income Shown in ITR
selfYNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
spouse ** Nil
** Nil
** Nil
** Nil
** Nil
huf ** Nil
** Nil
** Nil
** Nil
** Nil
dependent1 ** Nil
** Nil
** Nil
** Nil
** Nil
dependent2 ** Nil
** Nil
** Nil
** Nil
** Nil
dependent3 ** Nil
** Nil
** Nil
** Nil
** Nil
Data Readability Report of PAN and Income Tax :No Problems in Reading Affidavit Information

Details of Criminal Cases

No criminal cases

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Criminal Cases :No Problems in Reading Affidavit Information

Details of Movable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iCash 10,000  10 Thou+

5,000  5 Thou+

Nil 2,000  2 Thou+

1,000  1 Thou+

Nil Rs 18,000
18 Thou+
iiDeposits in Banks, Financial Institutions and Non-Banking Financial CompaniesIndian Overseas Bank, Ayyakaranpulam, A/C NO: 107601000022744
2,613  2 Thou+

Canara Bank Kariyapattinam, A/C NO: 1551101105726
1,029  1 Thou+

Tamilnadu Merchentile Bank, Thiruthuraipoondi, A/C NO: 258100050304135
404  4 Hund+

Canara Bank Kariyapattinam, A/C NO: 1551101109093
7,000  7 Thou+

NilIndian Overseas Bank Ayyakaranpulam, A/C NO: 107601000028857
2,500  2 Thou+

NilNil Rs 13,546
13 Thou+
iiiBonds, Debentures and Shares in companiesNilNilNilNilNilNil Nil
NSS, Postal Savings etc
NilNilNilNilNilNil Nil
LIC or other insurance Policies
NilNilNilNilNilNil Nil
vPersonal loans/advance given NilNilNilNilNilNil Nil
viMotor Vehicles (details of make, etc.)Bajaj Platina, TN 51 AL 7741(2019)
30,000  30 Thou+

NilNilNilNilNil Rs 30,000
30 Thou+
viiJewellery (give details weight value)2 Savaran
80,000  80 Thou+

NilNil1 Savaran
40,000  40 Thou+

2 Savaran
80,000  80 Thou+

Nil Rs 2,00,000
2 Lacs+
viiiOther assets, such as values of claims / interestsNilNilNilNilNilNil Nil
Gross Total Value (as per Affidavit) 1,24,046  1 Lacs+ 12,000  12 Thou+ Nil 44,500  44 Thou+ 81,000  81 Thou+ Nil Rs 2,61,546
2 Lacs+
Totals (Calculated as Sum of Values) Rs 1,24,046
1 Lacs+
Rs 12,000
12 Thou+
Rs 44,500
44 Thou+
Rs 81,000
81 Thou+
Rs 2,61,546
2 Lacs+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Movable Assets :No Problems in Reading Affidavit Information

Details of Immovable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iAgricultural LandNilNilNilNilNilNil Nil
iiNon Agricultural LandNilNilNilNilNilNil Nil
iiiCommercial BuildingsNilNilNilNilNilNil Nil
ivResidential BuildingsNilMarundur North Sethi, Vedharanyam (TK)
Total Area 3000 sq.ft
Built Up Area 1800 sq.ft
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
8,00,000  8 Lacs+

NilNilNilNil Rs 8,00,000
8 Lacs+
vOthersNilNilNilNilNilNil Nil
Total Current Market Value of (i) to (v) (as per Affidavit) Nil 8,00,000  8 Lacs+ Nil Nil Nil Nil Rs 8,00,000
8 Lacs+
Totals Calculated Nil
Rs 8,00,000
8 Lacs+
Rs 8,00,000
8 Lacs+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Immovable Assets :No Problems in Reading Affidavit Information

Details of Liabilities

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iLoans from Banks / FIsCanara Bank Kariyapattinam, A/C NO: 1551101105726, Gold Loan
10,000  10 Thou+

NilNilNilNilNil Rs 10,000
10 Thou+
Loans due to Individual / EntityNilNilNilNilNilNil Nil
Any other LiabilityNilNilNilNilNilNil Nil
Grand Total of Liabilities (as per affidavit) Nil Nil Nil Nil Nil Nil Nil
iiDues to departments dealing with government accommodationNilNilNilNilNilNil Nil
Dues to departments dealing with supply of waterNilNilNilNilNilNil Nil
Dues to departments dealing with supply of electricityNilNilNilNilNilNil Nil
Dues to departments dealing with telephonesNilNilNilNilNilNil Nil
Dues to departments dealing with supply of transportNilNilNilNilNilNil Nil
Income Tax DuesNilNilNilNilNilNil Nil
Wealth Tax DuesNilNilNilNilNilNil Nil
Service Tax DuesNilNilNilNilNilNil Nil
Property Tax DuesNilNilNilNilNilNil Nil
Sales Tax DuesNilNilNilNilNilNil Nil
GST DuesNilNilNilNilNilNil Nil
Any Other DuesNilNilNilNilNilNil Nil
iiiGrand Total of all Govt Dues (as per affidavit) Nil Nil Nil Nil Nil Nil Nil
ivWhether any other liabilities are in dispute, if so, mention the amount involved and the authority before which it is pendingNilNilNilNilNilNil Nil
Totals (Calculated as Sum of Values) Rs 10,000
10 Thou+
Rs 10,000
10 Thou+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Liabilities :No Problems in Reading Affidavit Information

Profession or Occupation

Self Agriculture
Spouse Nil

Sources Of Income (Details)

Self Agriculture
Spouse Nil
Dependent Nil

Contracts with appropriate Govt. and any public company/companies

Details of contracts entered by the candidate NIL
Details of contracts entered into by spouse NIL
Details of contracts entered into by dependent NIL
Details of contracts entered into by Hindu undivided family or trust in which the candidate or spouse or dependents have interest NIL
Details of contracts entered into by Partnership Firms in which the candidate or spouse or dependents are partners NIL
Details of contracts entered into by Private Companies in which candidate or spouse or dependents have share NIL

If you notice any discrepancy between affidavits and our data, you can use the message box below to send a message to us.

( यदि आप हलफनामों और इस पेज पर दी गयी जानकारी के बीच कोई विसंगति/भिन्नता पाते है तो आप नीचे के संदेश बॉक्स के उपयोग से हमें संदेश भेज सकते हैं)

Phone No
Enter your discrepancy
Please enter the code shown below and click Submit.

Share On:
Download App Follow us on

Disclaimer: All information on this website has been taken by ADR from the website of the Election Commission of India ( and all the information is available in public domain. ADR does not add or subtract any information, unless the EC changes the data. In particular, no unverified information from any other source is used. While all efforts have been made by ADR to ensure that the information is in keeping with what is available in the ECI website, in case of discrepancy between information provided by ADR through this report, anyone and that given in the ECI website, the information available on the ECI website should be treated as correct and Association for Democratic Reforms and their volunteers are not responsible or liable for any direct, indirect special, or consequential damages, claims, demands, losses of any kind whatsoever, made, claimed, incurred or suffered by any party arising under or relating to the usage of data provided by ADR through this report. It is to be noted that ADR undertakes great care and adopts utmost due diligence in analysing and dissemination of the background information of the candidates furnished by them at the time of elections from the duly self-sworn affidavits submitted with the Election Commission of India. Such information is only aimed at highlighting the growing criminality in politics, increased misuse of money in elections so as to facilitate a system of transparency, accountability and good governance and to enable voters to form an informed choice. Therefore, it is expected that anyone using this report shall undertake due care and utmost precaution while using the data provided by ADR. ADR is not responsible for any mishandling, discrepancy, inability to understand, misinterpretation or manipulation, distortion of the data in such a way so as to benefit or target a particular political party or politician or candidate.

About MyNeta About ADR State Coordinators Contact Terms of Use FAQs