Myneta.info is an open data repository platform of Association for Democratic Reforms (ADR).
Myneta Logo Myneta Logo
Home Lok Sabha State Assemblies Rajya Sabha Political Parties Electoral Bonds || माय नेता हिंदी में || About MyNeta About ADR
State Assemblies Rajya Sabha Political Parties
1 2 3 4
HomeTamilNadu 2026NAGAPATTINAMVEDHARANYAMKARTHICK. T(Criminal & Asset Declaration)

TamilNadu 2026

profile image

KARTHICK. T

VEDHARANYAM (NAGAPATTINAM)
Party:Naam Tamilar Katchi
S/o|D/o|W/o: TAMILSELVAN
Age: 35
Name Enrolled as Voter in: 166 THIRUTHURAIPOONDI constituency, at Serial no 194 in Part no 287

Self Profession:Youtuber thambichannel@gmail.com Youtube Channel, Chennai
Spouse Profession:NA

Crime-O-Meter


Number of Criminal Cases: 12

Assets & Liabilities


Assets: Rs 88,814 ~88 Thou+
Liabilities: Nil

Educational Details


Category: Graduate Professional
B.E from Sams College of Engineering and Technology, Pannampakkam, Chennai in 2011- 2014

Details of PAN and status of Income Tax return

Relation TypePAN GivenFinancial YearTotal Income Shown in ITR
selfYNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
spouse ** Nil
** Nil
** Nil
** Nil
** Nil
huf ** Nil
** Nil
** Nil
** Nil
** Nil
dependent1 ** Nil
** Nil
** Nil
** Nil
** Nil
dependent2 ** Nil
** Nil
** Nil
** Nil
** Nil
dependent3 ** Nil
** Nil
** Nil
** Nil
** Nil
Data Readability Report of PAN and Income Tax :No Problems in Reading Affidavit Information

Details of Criminal Cases

Brief Details of IPC / BNS

Cases where Pending

Serial No.FIR No.Case No.Court LAW / Section Type IPC/BNS Sections ApplicableOther Details / Other Acts / Sections Applicable Charges Framed Date on which charges were framedAppeal FiledDetails and present status of appeal
1 Cr.No. 38/2025, Erode Town Police Station CC No. 752/2025 JM - 2, Erode BNS 296(b), 115(2), 351(2) Yes 03 Sep 2025No
2 Cr.No.27/2025, Erode Town Police Station STC No. 1286/2025 JM - 2, Erode BNS 174 Yes 01 Sep 2025No
3 Cr.No. 37/2025, Erode Town Police Station STC No. 1290/2025 JM - 2, Erode BNS 191(2), 174, 132 Yes 01 Sep 2025No
4 Cr.No.29/2025, Erode Town Police Station STC No. 1287/2025 JM - 2, Erode BNS 192(2), 174, 132 Yes 01 Sep 2025No
5 Cr.No.30/2025, Erode Town Police Station STC No. 1288/2025 JM - 2, Erode BNS 192(2), 174, 132 Yes 01 Sep 2025No
6 46/2023, UKKADAM Police Station IPC 153A(1)(a), 505(2), 505(2) No No
7 25/2023, PERUGAVAZHANTHAN Police Station CC No. 152/2023 Judicial Magistrate Court, Mannargudi IPC 294b, 505(2), 506(2) Yes 30 May 2023No
8 322/2023, Cantonment Police Station Trichy City CC No. 44/2026 Chief Judicial Magistrate Court, Trichy IPC 143, 153, 504, 506(1), Section - 41(6)(a) of TNCP Act Yes 03 Jan 2026No
9 798/2021, Nungambakkam Police Station CC No. 9733/2021 Chief Metropolitan Magistrate Court Egmore Chennai IPC 143, 269, 270 Section - 41(6)(a) of TNCP Act Yes 30 Dec 2021No
10 702/2021, Nungam-Bakkam Police Station CC No. 9734/2021 Chief Metropolitan Magistrate Court Egmore Chennai IPC 143, 269, 270 Section - 41 of TNCP Act Yes 30 Dec 2021No
11 316/2018, Triplicane Police Station CC No. 8091/2018 Chief Metropolitan Magistrate Court Egmore Chennai IPC 294b, 323, 332, 336, 341, 353, 427, 506(2) Yes 09 Nov 2018No
12 227/2018, Triplicane Police Station CC No. 6280/2019 Chief Metropolitan Magistrate Court Egmore Chennai IPC 147, 148, 294b, 307, 332, 336, 353, 506(2) Yes 23 Aug 2019No

Cases where Convicted

Serial No.Case No.Court LAW / Section Type IPC/BNS Sections ApplicableOther Details / Other Acts / Sections Applicable Punishment ImposedDate on which convictedAppeal FiledDetails and present status of appeal
---------No Cases--------

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Criminal Cases :No Problems in Reading Affidavit Information

Details of Movable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iCash 30,000  30 Thou+

NilNil 5,000  5 Thou+

NilNil Rs 35,000
35 Thou+
iiDeposits in Banks, Financial Institutions and Non-Banking Financial CompaniesDBS Bank, Muthupettai
23,829  23 Thou+

Kotak Mahindra Bank, Chennai, Porur
4,690  4 Thou+

BOB
 

NilNilTamilnad Mercantile Bank (TMB), Idumbavanam
5,295  5 Thou+

NilNil Rs 33,814
33 Thou+
iiiBonds, Debentures and Shares in companiesNilNilNilNilNilNil Nil
iv(a)
NSS, Postal Savings etc
NilNilNilNilNilNil Nil
(b)
LIC or other insurance Policies
NilNilNilNilNilNil Nil
vPersonal loans/advance given NilNilNilNilNilNil Nil
viMotor Vehicles (details of make, etc.)NilNilNilNilNilNil Nil
viiJewellery (give details weight value)NilNilNilNilNilNil Nil
viiiOther assets, such as values of claims / interestsNilNilNilNilNilNil Nil
Gross Total Value (as per Affidavit) 58,519  58 Thou+ Nil Nil 10,295  10 Thou+ Nil Nil Rs 68,814
68 Thou+
Totals (Calculated as Sum of Values) Rs 58,519
58 Thou+
Nil
Nil
Rs 10,295
10 Thou+
Nil
Nil
Rs 68,814
68 Thou+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Movable Assets :No Problems in Reading Affidavit Information

Details of Immovable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iAgricultural LandNilNilNilNilNilNil Nil
iiNon Agricultural LandNilNilNilNilNilNil Nil
iiiCommercial BuildingsNilNilNilNilNilNil Nil
ivResidential BuildingsNilNilNilIdumbavanam Overhead forest, Land Belonging to arulmigu mangala nayaki temple in the name of my spouse tamil selvan
Total Area 1000 sqft
Built Up Area 300 sqft
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 20000.00
20,000  20 Thou+

NilNil Rs 20,000
20 Thou+
vOthersNilNilNilNilNilNil Nil
Total Current Market Value of (i) to (v) (as per Affidavit) Nil Nil Nil 20,000  20 Thou+ Nil Nil Rs 20,000
20 Thou+
Totals Calculated Nil
Nil
Nil
Rs 20,000
20 Thou+
Nil
Nil
Rs 20,000
20 Thou+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Immovable Assets :No Problems in Reading Affidavit Information

Details of Liabilities

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iLoans from Banks / FIsNilNilNilNilNilNil Nil
Loans due to Individual / EntityNilNilNilNilNilNil Nil
Any other LiabilityNilNilNilNilNilNil Nil
Grand Total of Liabilities (as per affidavit) Nil Nil Nil Nil Nil Nil Nil
iiDues to departments dealing with government accommodationNilNilNilNilNilNil Nil
Dues to departments dealing with supply of waterNilNilNilNilNilNil Nil
Dues to departments dealing with supply of electricityNilNilNilNilNilNil Nil
Dues to departments dealing with telephonesNilNilNilNilNilNil Nil
Dues to departments dealing with supply of transportNilNilNilNilNilNil Nil
Income Tax DuesNilNilNilNilNilNil Nil
Wealth Tax DuesNilNilNilNilNilNil Nil
Service Tax DuesNilNilNilNilNilNil Nil
Property Tax DuesNilNilNilNilNilNil Nil
Sales Tax DuesNilNilNilNilNilNil Nil
GST DuesNilNilNilNilNilNil Nil
Any Other DuesNilNilNilNilNilNil Nil
iiiGrand Total of all Govt Dues (as per affidavit) Nil Nil Nil Nil Nil Nil Nil
ivWhether any other liabilities are in dispute, if so, mention the amount involved and the authority before which it is pendingNilNilNilNilNilNil Nil
Totals (Calculated as Sum of Values) Nil
Nil
Nil
Nil
Nil
Nil
Nil

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Liabilities :No Problems in Reading Affidavit Information

Profession or Occupation .

Self Youtuber thambichannel@gmail.com Youtube Channel, Chennai
Spouse NA

Sources Of Income (Details)

Self Youtuber thambichannel@gmail.com Youtube Channel, Chennai
Spouse NA
Dependent NA

Contracts with appropriate Govt. and any public company/companies

Details of contracts entered by the candidate NA
Details of contracts entered into by spouse NA
Details of contracts entered into by dependent NA
Details of contracts entered into by Hindu undivided family or trust in which the candidate or spouse or dependents have interest NA
Details of contracts entered into by Partnership Firms in which the candidate or spouse or dependents are partners NA
Details of contracts entered into by Private Companies in which candidate or spouse or dependents have share NA



If you notice any discrepancy between affidavits and our data, you can use the message box below to send a message to us.

( यदि आप हलफनामों और इस पेज पर दी गयी जानकारी के बीच कोई विसंगति/भिन्नता पाते है तो आप नीचे के संदेश बॉक्स के उपयोग से हमें संदेश भेज सकते हैं)

Name
Email
Phone No
Enter your discrepancy
Please enter the code shown below and click Submit.



Share On:
Download App Follow us on

Disclaimer: All information on this website has been taken by ADR from the website of the Election Commission of India (https://affidavitarchive.nic.in/) and all the information is available in public domain. ADR does not add or subtract any information, unless the EC changes the data. In particular, no unverified information from any other source is used. While all efforts have been made by ADR to ensure that the information is in keeping with what is available in the ECI website, in case of discrepancy between information provided by ADR through this report, anyone and that given in the ECI website, the information available on the ECI website should be treated as correct and Association for Democratic Reforms and their volunteers are not responsible or liable for any direct, indirect special, or consequential damages, claims, demands, losses of any kind whatsoever, made, claimed, incurred or suffered by any party arising under or relating to the usage of data provided by ADR through this report. It is to be noted that ADR undertakes great care and adopts utmost due diligence in analysing and dissemination of the background information of the candidates furnished by them at the time of elections from the duly self-sworn affidavits submitted with the Election Commission of India. Such information is only aimed at highlighting the growing criminality in politics, increased misuse of money in elections so as to facilitate a system of transparency, accountability and good governance and to enable voters to form an informed choice. Therefore, it is expected that anyone using this report shall undertake due care and utmost precaution while using the data provided by ADR. ADR is not responsible for any mishandling, discrepancy, inability to understand, misinterpretation or manipulation, distortion of the data in such a way so as to benefit or target a particular political party or politician or candidate.

About MyNeta About ADR State Coordinators Contact Terms of Use FAQs